PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02924.1.g00040.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 353aa    MW: 38505.4 Da    PI: 6.9313
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02924.1.g00040.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY376.8e-12105126223
                                     --SS-EEEEEEE--TT-SS-EE CS
                            WRKY   2 dDgynWrKYGqKevkgsefprs 23 
                                     +DgynWrKYGqK+vkgse+pr 
  Zpz_sc02924.1.g00040.1.sm.mkhc 105 EDGYNWRKYGQKHVKGSENPRR 126
                                     8*******************96 PP

2WRKY108.62.9e-34245303159
                                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                     ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+++dpk v++tYeg+Hnhe
  Zpz_sc02924.1.g00040.1.sm.mkhc 245 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHNGCPVRKHVERASHDPKSVITTYEGKHNHE 303
                                     59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.7E-996126IPR003657WRKY domain
PROSITE profilePS5081111.50899149IPR003657WRKY domain
SuperFamilySSF1182905.1E-8103126IPR003657WRKY domain
SMARTSM007748.5E-5104132IPR003657WRKY domain
PfamPF031063.4E-7105126IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.3E-38230305IPR003657WRKY domain
SuperFamilySSF1182903.01E-30237305IPR003657WRKY domain
PROSITE profilePS5081138.343240305IPR003657WRKY domain
SMARTSM007741.3E-39245304IPR003657WRKY domain
PfamPF031065.4E-27246303IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MAAIINKSTH PDILPSPRNK SVGNGHEDEG SQDFEFKPHL NSSTQSMDST HKVNGSSGPN  60
QPVAMVGLSD SMPSEVGTSE LQQMNSSENA VQETHSENVA EKSAEDGYNW RKYGQKHVKG  120
SENPRRRHNH PKPQPNRRLT AGAVPSSQGE EKYDVATAEV KSGVSDLCNA VHSAGMIEPA  180
LGPASDDDID AGGGRPYPGD DANEDDDLDS KRRKMESAGI DAALMGKPNR EPRVVVQTVS  240
EVDILDDGYR WRKYGQKVVK GNPNPRSYYK CTHNGCPVRK HVERASHDPK SVITTYEGKH  300
NHEVPASRNA SHEISTAPMK TTRRLRLAVI AITTLAYPNP VSPYLPIDYS SGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-38236306878Probable WRKY transcription factor 4
2lex_A9e-38236306878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0548881e-150BT054888.1 Zea mays full-length cDNA clone ZM_BFc0109P23 mRNA, complete cds.
GenBankBT0617141e-150BT061714.1 Zea mays full-length cDNA clone ZM_BFb0176N11 mRNA, complete cds.
GenBankKJ7278611e-150KJ727861.1 Zea mays clone pUT5953 WRKY transcription factor (WRKY1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695163.11e-177PREDICTED: WRKY transcription factor SUSIBA2-like
SwissprotQ6VWJ61e-174WRK46_HORVU; WRKY transcription factor SUSIBA2
TrEMBLA0A0E0EDN91e-178A0A0E0EDN9_9ORYZ; Uncharacterized protein
STRINGOB07G25880.11e-176(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67403851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.18e-75WRKY family protein